Categories
Mothers Day Gifts
Mothers Day Gifts
 Mothers Day Gifts Ramadan and Eid
Ramadan and Eid
 Ramadan and Eid All Jewellery & Watches
All Jewellery & Watches
All Jewellery & Watches
- Rings- Boxed jewellery- Clover range- 18k Gold Range- Bracelets- Necklaces- Earrings- Prepackaged jewellery- Gemstone crystal range- Sterling silver jewellery- Watches- Hand made items
All Gifts
All Gifts
All Gifts
- Stickers- Jewellery Gifts- Gift sets- Face masks and skin care- Cards- All Items
Lux Clover Boutique
Lux Clover Boutique
 Lux Clover Boutique Specialist gifting services
Specialist gifting services
 Specialist gifting services Kids jewellery, gifts & accessories
Kids jewellery, gifts & accessories
 Kids jewellery, gifts & accessories Branded items all
Branded items all
Branded items all
- Branded clothing- Branded accessories and gifts
Sale
Sale
Sale
- Clearance
Lux Gallery of Gifting
Lux Gallery of Gifting
 Lux Gallery of Gifting Fragrances and Perfume
Fragrances and Perfume
 Fragrances and Perfume
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
£0.00
HomeAbout usCartContact us online formOffers
Categories
Mothers Day Gifts
Mothers Day Gifts
 Mothers Day Gifts Ramadan and Eid
Ramadan and Eid
 Ramadan and Eid All Jewellery & Watches
All Jewellery & Watches
All Jewellery & Watches
- Rings- Boxed jewellery- Clover range- 18k Gold Range- Bracelets- Necklaces- Earrings- Prepackaged jewellery- Gemstone crystal range- Sterling silver jewellery- Watches- Hand made items
All Gifts
All Gifts
All Gifts
- Stickers- Jewellery Gifts- Gift sets- Face masks and skin care- Cards- All Items
Lux Clover Boutique
Lux Clover Boutique
 Lux Clover Boutique Specialist gifting services
Specialist gifting services
 Specialist gifting services Kids jewellery, gifts & accessories
Kids jewellery, gifts & accessories
 Kids jewellery, gifts & accessories Branded items all
Branded items all
Branded items all
- Branded clothing- Branded accessories and gifts
Sale
Sale
Sale
- Clearance
Lux Gallery of Gifting
Lux Gallery of Gifting
 Lux Gallery of Gifting Fragrances and Perfume
Fragrances and Perfume
 Fragrances and Perfume
Sheet face mask skincare panda Christmas gift stocking filler

Sheet face mask skincare panda Christmas gift stocking filler

RRP £1.50
£1.00
Product Code: JxmFmWD
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i