GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
£0.00
Gold and Red earrings boxed gift
Gold and Red earrings boxed gift Gold and Red earrings boxed gift Gold and Red earrings boxed gift Gold and Red earrings boxed gift Gold and Red earrings boxed gift Gold and Red earrings boxed gift Gold and Red earrings boxed gift Gold and Red earrings boxed gift Gold and Red earrings boxed gift Gold and Red earrings boxed gift Gold and Red earrings boxed gift Gold and Red earrings boxed gift Gold and Red earrings boxed gift Gold and Red earrings boxed gift Gold and Red earrings boxed gift Gold and Red earrings boxed gift

Gold and Red earrings boxed gift

£5.99 inc. tax

Gold and Red earrings pair presented in a red gift box as part of our sessional gifts range. Materials: Made of plastic with jelly backs.

Product Code: yA3AzzP
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i