GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
£0.00
Laura Ashley body spray three piece Gift Set
Laura Ashley body spray three piece Gift Set Laura Ashley body spray three piece Gift Set

Laura Ashley body spray three piece Gift Set

Notify me when product is back in stock
£10.00 inc. tax
Laura Ashley three piece Gift Set heritage bloom collection includes body spray, lip balm and nail file. The perfect gift.
Product Code: bPxJUNQ
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i