GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
£0.00
Gold clover jewellery set necklace and earrings boxed Vca style Christmas gift stocking filler
Gold clover jewellery set necklace and earrings boxed Vca style Christmas gift stocking filler Gold clover jewellery set necklace and earrings boxed Vca style Christmas gift stocking filler Gold clover jewellery set necklace and earrings boxed Vca style Christmas gift stocking filler Gold clover jewellery set necklace and earrings boxed Vca style Christmas gift stocking filler Gold clover jewellery set necklace and earrings boxed Vca style Christmas gift stocking filler Gold clover jewellery set necklace and earrings boxed Vca style Christmas gift stocking filler Gold clover jewellery set necklace and earrings boxed Vca style Christmas gift stocking filler Gold clover jewellery set necklace and earrings boxed Vca style Christmas gift stocking filler Gold clover jewellery set necklace and earrings boxed Vca style Christmas gift stocking filler

Gold clover jewellery set necklace and earrings boxed Vca style Christmas gift stocking filler

RRP £10.99
£8.50 inc. tax

Black five leaf clover set necklace and earrings gift set Boxed, gold colour fashion costume jewellery. Presented in a pink box making it ideal for gifting for any occasion. 

Product Code: qyRaqQc
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i