GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBYRBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMROMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXOFXPFYERZARZMWZWL
£0.00
Ladies earrings gift 18k gold earrings with diamond details
Ladies earrings gift 18k gold earrings with diamond details Ladies earrings gift 18k gold earrings with diamond details Ladies earrings gift 18k gold earrings with diamond details Ladies earrings gift 18k gold earrings with diamond details Ladies earrings gift 18k gold earrings with diamond details Ladies earrings gift 18k gold earrings with diamond details Ladies earrings gift 18k gold earrings with diamond details Ladies earrings gift 18k gold earrings with diamond details

Ladies earrings gift 18k gold earrings with diamond details

RRP £9.99
£5.00 inc. tax

18k gold platted earrings with faux diamond details x2 little diamonds drop. Comes wrapped in sealed holographic bag making it the ideal gift 

Product Code: Ylk2VI7
Product Condition: New
Updating Order Details
Please do not refresh or navigate away from the page!
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore.com
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Fully loaded webstore
Unlimited products
Domain & SSL
checkout
24/7 support
And more...
Why freewebstore?
15+ years
1 million stores created
No card required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i